What is the catalog number for CTSL Peptide - middle region?

The catalog number for CTSL Peptide - middle region is orb1998036.

What sizes are available for CTSL Peptide - middle region?

CTSL Peptide - middle region is available in the following size(s): 100 µg.

Is CTSL Peptide - middle region in stock?

CTSL Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CTSL Peptide - middle region

Product Specifications

Product Name Alternative

Fs, MEP, nkt, CatL, Ctsl1, 1190035F06Rik

UniProt

P06797

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034114.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

abx986180-01 150 µg

Rat PTTG1 shRNA Plasmid

Sign In for Pricing

View Details

abx986180-02 300 µg

Rat PTTG1 shRNA Plasmid

Sign In for Pricing

View Details

SIPD311Mu01-01 10 µg

Recombinant Lipolysis Stimulated Lipoprotein Receptor (LSR)

Sign In for Pricing

View Details

SIPD311Mu01-02 50 µg

Recombinant Lipolysis Stimulated Lipoprotein Receptor (LSR)

Sign In for Pricing

View Details

SIPD311Mu01-03 200 µg

Recombinant Lipolysis Stimulated Lipoprotein Receptor (LSR)

Sign In for Pricing

View Details

SIPD311Mu01-04 1 mg

Recombinant Lipolysis Stimulated Lipoprotein Receptor (LSR)

Sign In for Pricing

View Details