HSD17B3 Peptide - middle region
HSD17B3 Peptide - middle region
Product Specifications
Product Name Alternative
EDH17B3, SDR12C2
UniProt
P37058
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_000188.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CSB-RP141574pl-01 20 µg
Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1 (PYL1) , partial
Sign In for Pricing
View Details CSB-RP141574pl-02 100 µg
Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1 (PYL1) , partial
Sign In for Pricing
View Details CSB-RP141574pl-03 1 mg
Recombinant Arabidopsis thaliana Abscisic acid receptor PYL1 (PYL1) , partial
Sign In for Pricing
View Details