Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B3 Peptide - middle region

HSD17B3 Peptide - middle region

Product Specifications

Product Name Alternative

EDH17B3, SDR12C2

UniProt

P37058

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000188.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig ACO2/Aconitate hydratase, mitochondrial ELISA Kit
E0002Pi 96 Tests

Pig ACO2/Aconitate hydratase, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Uqcrb (NM_001127553) Rat Tagged ORF Clone
RR211140 10 µg

Uqcrb (NM_001127553) Rat Tagged ORF Clone

Sign In for Pricing
View Details
RGD1562699 Protein Vector (Rat) (pPB-N-His)
PV300603 500 ng

RGD1562699 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
MIR205HG (NM_001104548) Human Tagged ORF Clone Lentiviral Particle
RC215980L4V 200 µL

MIR205HG (NM_001104548) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ATP5A1P10 Protein Lysate (Human) with C-Ha Tag
12698031 100 µg

ATP5A1P10 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
FAM63B Antibody
orb1269007 400 μl

FAM63B Antibody

Sign In for Pricing
View Details