Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE7B Peptide - C-terminal region

PDE7B Peptide - C-terminal region

Product Specifications

UniProt

Q9QXQ1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001334295.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPLFREWARFTGNSTLSENMLSHLAHNKAQWKSLLSNQHRRRGSGQDLAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thbs1 Mouse Gene Knockout Kit (CRISPR)
KN517517 1 Kit

Thbs1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Snx11 Mouse Gene Knockout Kit (CRISPR)
KN516423 1 Kit

Snx11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PSMG2 antibody
FNab09884 100 µg

PSMG2 antibody

Sign In for Pricing
View Details
Wdr47 Mouse Gene Knockout Kit (CRISPR)
KN519364 1 Kit

Wdr47 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant EIF4E Antibody
RC-5359-01 50 μL

Recombinant EIF4E Antibody

Sign In for Pricing
View Details
Recombinant EIF4E Antibody
RC-5359-02 100 µL

Recombinant EIF4E Antibody

Sign In for Pricing
View Details