Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE7B Peptide - C-terminal region

PDE7B Peptide - C-terminal region

Product Specifications

UniProt

Q9QXQ1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001334295.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPLFREWARFTGNSTLSENMLSHLAHNKAQWKSLLSNQHRRRGSGQDLAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PET™, 100 ml
0405 100 mL

PET™, 100 ml

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS807223 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) ELISA Kit
RDR-GCLM-Hu-01 96 Tests

Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) ELISA Kit

Sign In for Pricing
View Details
Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) ELISA Kit
RDR-GCLM-Hu-02 48 Tests

Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) ELISA Kit

Sign In for Pricing
View Details
Melamine (MEL) ELISA Kit
RDF-E109 96 Tests

Melamine (MEL) ELISA Kit

Sign In for Pricing
View Details
N1-Nornicergoline
TRC-N756600-2.5MG 2.5 mg

N1-Nornicergoline

Sign In for Pricing
View Details