EZH2 Peptide - middle region
EZH2 Peptide - middle region
Product Specifications
Product Name Alternative
KMT6, Enx-1, Enx1h, mKIAA4065
UniProt
Q61188
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_031997.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: INDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1165563-01 0.02 mg (E-Coli)
Recombinant Lepidosiren paradoxus Calhepatin
Sign In for Pricing
View Details MBS1165563-02 0.1 mg (E-Coli)
Recombinant Lepidosiren paradoxus Calhepatin
Sign In for Pricing
View Details MBS1165563-03 0.02 mg (Yeast)
Recombinant Lepidosiren paradoxus Calhepatin
Sign In for Pricing
View Details MBS1165563-04 0.1 mg (Yeast)
Recombinant Lepidosiren paradoxus Calhepatin
Sign In for Pricing
View Details MBS1165563-05 0.02 mg (Baculovirus)
Recombinant Lepidosiren paradoxus Calhepatin
Sign In for Pricing
View Details MBS1165563-06 1 mg (E-Coli)
Recombinant Lepidosiren paradoxus Calhepatin
Sign In for Pricing
View Details