Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EZH2 Peptide - middle region

EZH2 Peptide - middle region

Product Specifications

Product Name Alternative

KMT6, Enx-1, Enx1h, mKIAA4065

UniProt

Q61188

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031997.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit delta (atpH)
MBS1340179-01 0.02 mg (E-Coli)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit delta (atpH)
MBS1340179-02 0.1 mg (E-Coli)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit delta (atpH)
MBS1340179-03 0.02 mg (Yeast)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit delta (atpH)
MBS1340179-04 0.1 mg (Yeast)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit delta (atpH)
MBS1340179-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit delta (atpH)
MBS1340179-06 0.02 mg (Mammalian-Cell)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details