What is the catalog number for ASL Peptide - middle region?

The catalog number for ASL Peptide - middle region is orb1998023.

What sizes are available for ASL Peptide - middle region?

ASL Peptide - middle region is available in the following size(s): 100 µg.

Is ASL Peptide - middle region in stock?

ASL Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ASL Peptide - middle region

Product Specifications

Product Name Alternative

2510006M18Rik

UniProt

Q91YI0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598529.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS1146669-01 0.02 mg (E-Coli)

Recombinant Sorangium cellulosum (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing

View Details

MBS1146669-02 0.1 mg (E-Coli)

Recombinant Sorangium cellulosum (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing

View Details

MBS1146669-03 0.02 mg (Yeast)

Recombinant Sorangium cellulosum (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing

View Details

MBS1146669-04 0.1 mg (Yeast)

Recombinant Sorangium cellulosum (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing

View Details

MBS1146669-05 0.02 mg (Baculovirus)

Recombinant Sorangium cellulosum (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing

View Details

MBS1146669-06 0.02 mg (Mammalian-Cell)

Recombinant Sorangium cellulosum (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

Sign In for Pricing

View Details