Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASL Peptide - middle region

ASL Peptide - middle region

Product Specifications

Product Name Alternative

2510006M18Rik

UniProt

Q91YI0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598529.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF beta/LTA Rabbit Polyclonal Antibody (APC)
orb2579284 100 µg

TNF beta/LTA Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Bovine Intact PaHormone (i-PTH) ELISA Kit
NSL0484Bo 96 Tests

Bovine Intact PaHormone (i-PTH) ELISA Kit

Sign In for Pricing
View Details
Orai2 Polyclonal Antibody
bs-9541R 100 µL

Orai2 Polyclonal Antibody

Sign In for Pricing
View Details
SH3TC1 Protein Vector (Rat) (pPM-C-His)
PV304785 500 ng

SH3TC1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
PRAMEF18 ORF Vector (Human) (pORF)
ORF028256 1.0 µg DNA

PRAMEF18 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human PPP1R9A/Neurabin-1 ELISA Kit
MBS2907494-01 48 Well

Human PPP1R9A/Neurabin-1 ELISA Kit

Sign In for Pricing
View Details