STRAP Peptide - middle region
STRAP Peptide - middle region
Product Specifications
Product Name Alternative
Unrip, C78091, C79202, AW557906
UniProt
Q9Z1Z2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_035629.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1069981 Inquire
Recombinant Bacillus subtilis Uncharacterized protein ylqG (ylqG), partial
Sign In for Pricing
View Details MBS732226-01 48 Well
Guinea Pig cysteinyl aspartate specific proteinases 3 ELISA Kit
Sign In for Pricing
View Details MBS732226-02 96 Well
Guinea Pig cysteinyl aspartate specific proteinases 3 ELISA Kit
Sign In for Pricing
View Details MBS732226-03 5x 96 Well
Guinea Pig cysteinyl aspartate specific proteinases 3 ELISA Kit
Sign In for Pricing
View Details MBS732226-04 10x 96 Well
Guinea Pig cysteinyl aspartate specific proteinases 3 ELISA Kit
Sign In for Pricing
View Details 