Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STRAP Peptide - middle region

STRAP Peptide - middle region

Product Specifications

Product Name Alternative

Unrip, C78091, C79202, AW557906

UniProt

Q9Z1Z2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035629.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal USP11 Antibody
NB100-1251 0.1 mg

Goat Polyclonal USP11 Antibody

Sign In for Pricing
View Details
Mouse Apolipoprotein E, Apo-E ELISA KIT
EA0006Mo-01 96 Well

Mouse Apolipoprotein E, Apo-E ELISA KIT

Sign In for Pricing
View Details
Mouse Apolipoprotein E, Apo-E ELISA KIT
EA0006Mo-02 5x 96 Tests

Mouse Apolipoprotein E, Apo-E ELISA KIT

Sign In for Pricing
View Details
Mouse Apolipoprotein E, Apo-E ELISA KIT
EA0006Mo-03 10x 96 Tests

Mouse Apolipoprotein E, Apo-E ELISA KIT

Sign In for Pricing
View Details
Adam7 ORF Vector (Rat) (pORF)
ORF063059 1.0 µg DNA

Adam7 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Methyl 4-acrylamidobenzoate
OR1006119 100 mg

Methyl 4-acrylamidobenzoate

Sign In for Pricing
View Details