Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAPDH Peptide - middle region

GAPDH Peptide - middle region

Product Specifications

Product Name Alternative

G3PD, GAPD, HEL-S-162eP

UniProt

P04406

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243728.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cefiderocol Inner Salt Pyrrolidinium-D8
TRC-C167351-2.5MG 2.5 mg

Cefiderocol Inner Salt Pyrrolidinium-D8

Sign In for Pricing
View Details
Rhod-2, AM Ester
#50024 1x 1 mg

Rhod-2, AM Ester

Sign In for Pricing
View Details
HNF 4 alpha (HNF4A) (NM_001030004) Human Recombinant Protein
TP316588M 100 µg

HNF 4 alpha (HNF4A) (NM_001030004) Human Recombinant Protein

Sign In for Pricing
View Details
Synaptogyrin 4 (SYNGR4) Human Gene Knockout Kit (CRISPR)
KN418894 1 Kit

Synaptogyrin 4 (SYNGR4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Kappa Light Chain (TB28-2), CF568 conjugate, 0.1mg/mL
BNC680708-500 1x 500 µL

Kappa Light Chain (TB28-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NCF1 Antibody
OC-619-01 50 μL

NCF1 Antibody

Sign In for Pricing
View Details