Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP53 Peptide - middle region

TP53 Peptide - middle region

Product Specifications

Product Name Alternative

P53, BCC7, LFS1, TRP53

UniProt

P04637

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000537.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Parathyroid Hormone (PTH) ELISA Kit
YP-W74905-01 48 Tests

Sheep Parathyroid Hormone (PTH) ELISA Kit

Sign In for Pricing
View Details
Sheep Parathyroid Hormone (PTH) ELISA Kit
YP-W74905-02 96 Tests

Sheep Parathyroid Hormone (PTH) ELISA Kit

Sign In for Pricing
View Details
Mouse A Disintegrin And Metalloproteinase With Thrombospondin 5 (ADAMTS5) ELISA Kit
MBS2706829-01 24 Strip Well

Mouse A Disintegrin And Metalloproteinase With Thrombospondin 5 (ADAMTS5) ELISA Kit

Sign In for Pricing
View Details
Mouse A Disintegrin And Metalloproteinase With Thrombospondin 5 (ADAMTS5) ELISA Kit
MBS2706829-02 48 Well

Mouse A Disintegrin And Metalloproteinase With Thrombospondin 5 (ADAMTS5) ELISA Kit

Sign In for Pricing
View Details
Mouse A Disintegrin And Metalloproteinase With Thrombospondin 5 (ADAMTS5) ELISA Kit
MBS2706829-03 96 Well

Mouse A Disintegrin And Metalloproteinase With Thrombospondin 5 (ADAMTS5) ELISA Kit

Sign In for Pricing
View Details
Mouse A Disintegrin And Metalloproteinase With Thrombospondin 5 (ADAMTS5) ELISA Kit
MBS2706829-04 5x 96 Well

Mouse A Disintegrin And Metalloproteinase With Thrombospondin 5 (ADAMTS5) ELISA Kit

Sign In for Pricing
View Details