Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKB1 Peptide - middle region

NFKB1 Peptide - middle region

Product Specifications

Product Name Alternative

P50, KBF1, p105, EBP-1, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B

UniProt

P19838

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001158884.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC-24R Refrigerated High Speed Microcentrifuge with COMBI-Rotor, 230V
C2417-R-E 1 Each

MC-24R Refrigerated High Speed Microcentrifuge with COMBI-Rotor, 230V

Sign In for Pricing
View Details
alpha Actinin 4 (ACTN4) Rabbit Monoclonal Antibody
TA423243 100 µL

alpha Actinin 4 (ACTN4) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MTFMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C1]
TA503547BM 100 µL

MTFMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C1]

Sign In for Pricing
View Details
PLAAT2 Goat Polyclonal Antibody
AP33375PU-N 100 µg

PLAAT2 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Artn Mouse Gene Knockout Kit (CRISPR)
KN501635 1 Kit

Artn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FUT8 Human Gene Knockout Kit (CRISPR)
KN212345RB 1 Kit

FUT8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details