Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFKB1 Peptide - middle region

NFKB1 Peptide - middle region

Product Specifications

Product Name Alternative

P50, KBF1, p105, EBP-1, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B

UniProt

P19838

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001158884.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYNLT1 (NM_006519) Human Recombinant Protein
TP318331 20 µg

DYNLT1 (NM_006519) Human Recombinant Protein

Sign In for Pricing
View Details
CD117 (KIT/982), 0.2mg/mL
BNUB0982-500 1x 500 µL

CD117 (KIT/982), 0.2mg/mL

Sign In for Pricing
View Details
FITC Conjugated Anti-Mouse CD8 alpha Recombinant Antibody [PSH05-00] - Rabbit IgG (Chimeric)
HA720205F 100 µL

FITC Conjugated Anti-Mouse CD8 alpha Recombinant Antibody [PSH05-00] - Rabbit IgG (Chimeric)

Sign In for Pricing
View Details
TTC23L Human qPCR Primer Pair (NM_144725)
HP217296 200 Reactions

TTC23L Human qPCR Primer Pair (NM_144725)

Sign In for Pricing
View Details
HDAC10 Human Gene Knockout Kit (CRISPR)
KN418536 1 Kit

HDAC10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD170 Antibody[S17007L]
AN00629P-01 50 Tests

PE/Elab Fluor® 594 Anti-Mouse CD170 Antibody[S17007L]

Sign In for Pricing
View Details