Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL2 Peptide - middle region

BCL2 Peptide - middle region

Product Specifications

Product Name Alternative

Bcl-2, PPP1R50

UniProt

P10415

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000624.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF66 siRNA (h)
sc-97612 10 µM

ZNF66 siRNA (h)

Sign In for Pricing
View Details
URB937
MBS5759430 Inquire

URB937

Sign In for Pricing
View Details
BAIAP2 Mouse Monoclonal Antibody [Clone 8G8]
E45M11605V-2 50 µL

BAIAP2 Mouse Monoclonal Antibody [Clone 8G8]

Sign In for Pricing
View Details
(2E) -3-[4- (2-Oxopyrrolidin-1-yl) phenyl]prop-2-enoic acid
UHA92868-01 250 mg

(2E) -3-[4- (2-Oxopyrrolidin-1-yl) phenyl]prop-2-enoic acid

Sign In for Pricing
View Details
(2E) -3-[4- (2-Oxopyrrolidin-1-yl) phenyl]prop-2-enoic acid
UHA92868-02 2.5 g

(2E) -3-[4- (2-Oxopyrrolidin-1-yl) phenyl]prop-2-enoic acid

Sign In for Pricing
View Details
FH Antibody
orb1731974 100 µL

FH Antibody

Sign In for Pricing
View Details