BCL2 Peptide - middle region
BCL2 Peptide - middle region
Product Specifications
Product Name Alternative
Bcl-2, PPP1R50
UniProt
P10415
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_000624.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15129958 1 Vial
Lentiviral mouse Dnajc7 shRNA (UAS) - Lentiviral mouse Dnajc7 shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details 
bsm-61735R-BF555-01 20 µL
GLO1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
Sign In for Pricing
View Details 
bsm-61735R-BF555-02 100 µL
GLO1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
Sign In for Pricing
View Details K1404706 1.0 µg DNA
NCRNA00158 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details