SQSTM1 Peptide - middle region
SQSTM1 Peptide - middle region
Product Specifications
Product Name Alternative
P60, p62, A170, OSIL, PDB3, ZIP3, p62B, FTDALS3
UniProt
Q13501
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001135770.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPES
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
124623-ML650 100 µL
CD3E (T-cell Surface Glycoprotein CD3 epsilon Chain, T-cell Surface Antigen T3/Leu-4 epsilon Chain, T3E, CD3e) (MaxLight 650)
Sign In for Pricing
View Details TP321745M 100 µg
Pancreatic Lipase Related Protein 2 (PNLIPRP2) (NM_005396) Human Recombinant Protein
Sign In for Pricing
View Details