SQSTM1 Peptide - middle region
SQSTM1 Peptide - middle region
Product Specifications
Product Name Alternative
P60, p62, A170, OSIL, PDB3, ZIP3, p62B, FTDALS3
UniProt
Q13501
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001135770.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPES
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
133401G0-AAT 25 Tests
APC/iFluor® 750 Anti-human CD334 Antibody *4FR6D3*
Sign In for Pricing
View Details 
MBS9353003 Inquire
Fish Gamma-Aminobutyric Acid Receptor Subunit Alpha-1 (GABRA1) ELISA Kit
Sign In for Pricing
View Details 
TL516080V 500 µL Each
Sectm1a Mouse shRNA Lentiviral Particle (Locus ID 209588)
Sign In for Pricing
View Details