Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAD3 Peptide - N-terminal region

SMAD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436

UniProt

P84022

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138574.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC340502 Human qPCR Primer Pair (XM_291318)
HP221410 200 Reactions

LOC340502 Human qPCR Primer Pair (XM_291318)

Sign In for Pricing
View Details
34S-Phenylacetyl Disulfide
TRC-P335599-5MG 5 mg

34S-Phenylacetyl Disulfide

Sign In for Pricing
View Details
Tenascin (T2H5), CF647 conjugate, 0.1mg/mL
BNC470392-100 1x 100 µL

Tenascin (T2H5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Amelotin (AMTN) Mouse Monoclonal Antibody [Clone ID: OTI2B3]
CF808509 100 µg

Amelotin (AMTN) Mouse Monoclonal Antibody [Clone ID: OTI2B3]

Sign In for Pricing
View Details
BMP8B Human Gene Knockout Kit (CRISPR)
KN415336 1 Kit

BMP8B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FBXL2 Rabbit Polyclonal Antibody
R1706-15 100 µL

FBXL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details