Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIM Peptide - N-terminal region

VIM Peptide - N-terminal region

Product Specifications

Product Name Alternative

HEL113, CTRCT30

UniProt

P08670

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003371.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-5 p10, cleaved (S331) discontinued
534042-01 30ul

Caspase-5 p10, cleaved (S331) discontinued

Sign In for Pricing
View Details
Caspase-5 p10, cleaved (S331) discontinued
534042-02 100 µL

Caspase-5 p10, cleaved (S331) discontinued

Sign In for Pricing
View Details
Mmu-miR-3080-5p miRNA Mimic
orb1875433-01 5 nmol

Mmu-miR-3080-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-3080-5p miRNA Mimic
orb1875433-02 10 nmol

Mmu-miR-3080-5p miRNA Mimic

Sign In for Pricing
View Details
Cobalt Granules 1-1.5 mm, 99.99% (metals basis)
GX6216-50g 50 g

Cobalt Granules 1-1.5 mm, 99.99% (metals basis)

Sign In for Pricing
View Details
HAS3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV635818 1.0 µg DNA

HAS3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details