Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIM Peptide - N-terminal region

VIM Peptide - N-terminal region

Product Specifications

Product Name Alternative

HEL113, CTRCT30

UniProt

P08670

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003371.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0226 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1133408 1.0 µg DNA

KIAA0226 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Human Cerebellin-2/CBLN2 Protein, C-Fc
HA548021-01 50 µg

Recombinant Human Cerebellin-2/CBLN2 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human Cerebellin-2/CBLN2 Protein, C-Fc
HA548021-02 100 µg

Recombinant Human Cerebellin-2/CBLN2 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human Cerebellin-2/CBLN2 Protein, C-Fc
HA548021-03 1 mg

Recombinant Human Cerebellin-2/CBLN2 Protein, C-Fc

Sign In for Pricing
View Details
SEC31A Protein Vector (Rat) (pPB-C-His)
PV303874 500 ng

SEC31A Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPAC23A1.07 Polyclonal Antibody
MBS7180741 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPAC23A1.07 Polyclonal Antibody

Sign In for Pricing
View Details