Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAPDH Peptide - middle region

GAPDH Peptide - middle region

Product Specifications

Product Name Alternative

G3PD, GAPD, HEL-S-162eP

UniProt

P04406

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243728.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-4 / ERBB4 (ERBB4/2581), 1mg/mL
BNUM2581-50 1x 50 µL

HER-4 / ERBB4 (ERBB4/2581), 1mg/mL

Sign In for Pricing
View Details
Hepatocyte Specific (OCH1E5), Biotin conjugate, 0.1mg/mL
BNCB0671-100 1x 100 µL

Hepatocyte Specific (OCH1E5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXA1 / HNF3A (FOXA1/1516), 0.2mg/mL
BNUB1516-500 1x 500 µL

FOXA1 / HNF3A (FOXA1/1516), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human Mucin-1/MUC-1 Protein (Fc Tag)
PKSH032765-01 10 µg

Recombinant Human Mucin-1/MUC-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human Mucin-1/MUC-1 Protein (Fc Tag)
PKSH032765-02 50 µg

Recombinant Human Mucin-1/MUC-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), Biotin conjugate, 0.1mg/mL
BNCB1815-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details