Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC16A6 Peptide - C-terminal region

SLC16A6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MCT6, MCT7

UniProt

O15403

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001167637.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALVRPCKMGLCQHHHSGETKVVSHRGKTLQDIPEDFLEMDLAKNEHRVHV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H mgA1 Rabbit pAb
E45R19318N-100 100 µL

H mgA1 Rabbit pAb

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), 1mg/mL
BNUM1602-50 1x 50 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), 1mg/mL

Sign In for Pricing
View Details
GFP hsa-mir-4252 AAV miRNA Vector
Amh1063000 500 ng

GFP hsa-mir-4252 AAV miRNA Vector

Sign In for Pricing
View Details
HLA-B siRNA (h)
sc-42922 10 µM

HLA-B siRNA (h)

Sign In for Pricing
View Details
Serine Racemase Polyclonal Antibody, Biotin Conjugated
bs-10474R-Biotin 100 µL

Serine Racemase Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Desmin (DES, CMD1I, CSM1, CSM2, FLJ12025, FLJ39719, FLJ41013, FLJ41793) (MaxLight 750) discontinued
137921-ML750 100 µL

Desmin (DES, CMD1I, CSM1, CSM2, FLJ12025, FLJ39719, FLJ41013, FLJ41793) (MaxLight 750) discontinued

Sign In for Pricing
View Details