Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDCA8 Peptide - middle region

CDCA8 Peptide - middle region

Product Specifications

Product Name Alternative

BOR, DasraB, MESRGP, BOREALIN

UniProt

Q53HL2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243804.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTPRFDSRVFKTPGLRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Echidnotoxin Rabbit pAb, AE conjugated
orb2855273 100 µL

Echidnotoxin Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
SMAD9 Rabbit Polyclonal Antibody (FITC)
orb9837 100 µL

SMAD9 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0758 protein PSPA7_6095 (PSPA7_6095)
MBS1119147-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa UPF0758 protein PSPA7_6095 (PSPA7_6095)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0758 protein PSPA7_6095 (PSPA7_6095)
MBS1119147-02 0.1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa UPF0758 protein PSPA7_6095 (PSPA7_6095)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0758 protein PSPA7_6095 (PSPA7_6095)
MBS1119147-03 0.02 mg (Yeast)

Recombinant Pseudomonas aeruginosa UPF0758 protein PSPA7_6095 (PSPA7_6095)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0758 protein PSPA7_6095 (PSPA7_6095)
MBS1119147-04 0.1 mg (Yeast)

Recombinant Pseudomonas aeruginosa UPF0758 protein PSPA7_6095 (PSPA7_6095)

Sign In for Pricing
View Details