Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RMDN1 Peptide - C-terminal region

RMDN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RMD1, RMD-1, CGI-90, FAM82B

UniProt

Q96DB5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273636.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLGKTYLKLHNKKLAAFWLMKAKDYPAHTEEDKQIQTEAAQLLTSFSEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Baccatin III
TRC-B101000-25MG 25 mg

Baccatin III

Sign In for Pricing
View Details
PCNA (PC10), Biotin conjugate, 0.1mg/mL
BNCB0467-100 1x 100 µL

PCNA (PC10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLTP Rabbit Monoclonal Antibody
TA423724 100 µL

PLTP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
High Binding 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MG01F-HB8 50x 96 Well Plates

High Binding 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details
Pyrrole-2-carboxylic Acid
TRC-P997890-5G 5 g

Pyrrole-2-carboxylic Acid

Sign In for Pricing
View Details
TCHP (NM_001143852) Human Over-expression Lysate
LC428388 20 µg

TCHP (NM_001143852) Human Over-expression Lysate

Sign In for Pricing
View Details