Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TERF2IP Peptide - middle region

TERF2IP Peptide - middle region

Product Specifications

Product Name Alternative

RAP1, DRIP5

UniProt

Q9NYB0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_061848.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEEEEEEKVSQPEVGAAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Timm44 siRNA Oligos set (Rat)
46715176 3x 5 nmol

Timm44 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Vpr Antibody
orb843941 2 mg

Vpr Antibody

Sign In for Pricing
View Details
HSP90AB1 ELISA Kit (Human)
OKCD00689-96W 96 Well

HSP90AB1 ELISA Kit (Human)

Sign In for Pricing
View Details
Recombinant Human KLF4, N-His
MBS1572576-01 0.1 mg

Recombinant Human KLF4, N-His

Sign In for Pricing
View Details
Recombinant Human KLF4, N-His
MBS1572576-02 1 mg

Recombinant Human KLF4, N-His

Sign In for Pricing
View Details
Recombinant Human KLF4, N-His
MBS1572576-03 5x 1 mg

Recombinant Human KLF4, N-His

Sign In for Pricing
View Details