Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TST Peptide - middle region

TST Peptide - middle region

Product Specifications

Product Name Alternative

Rhodanese

UniProt

P52196

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033463.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eldelumab Biosimilar - Research Grade
ICH5146-100mg 100 mg

Eldelumab Biosimilar - Research Grade

Sign In for Pricing
View Details
IMPDH2 Rabbit Polyclonal Antibody
AP17504PU-N 400 µL

IMPDH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429UH-01 25 µg

PE/Cyanine7 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
AN00429UH-02 100 µg

PE/Cyanine7 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]

Sign In for Pricing
View Details
ID2 (NM_002166) Human Over-expression Lysate
LY400786 100 µg

ID2 (NM_002166) Human Over-expression Lysate

Sign In for Pricing
View Details
EphA6 (C-term) Rabbit Polyclonal Antibody
AP14285PU-N 400 µL

EphA6 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details