Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TST Peptide - middle region

TST Peptide - middle region

Product Specifications

Product Name Alternative

Rhodanese

UniProt

P52196

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033463.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H6PD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A7]
TA501257BM 100 µL

H6PD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A7]

Sign In for Pricing
View Details
Tissue FFPE Sections, Aorta
CS801609 5x 5 µm

Tissue FFPE Sections, Aorta

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF488A conjugate, 0.1mg/mL
BNC882171-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP Mouse Monoclonal Antibody [1-D4]
EM140707 100 µL

GFAP Mouse Monoclonal Antibody [1-D4]

Sign In for Pricing
View Details
MDM2 (MDM2/2414), Biotin conjugate, 0.1mg/mL
BNCB2414-100 1x 100 µL

MDM2 (MDM2/2414), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-[2-(Aminocarbonyl)-5-benzofuranyl]-1-piperazinecarboxylic Acid tert-Butyl Ester
TRC-A603140-10MG 10 mg

4-[2-(Aminocarbonyl)-5-benzofuranyl]-1-piperazinecarboxylic Acid tert-Butyl Ester

Sign In for Pricing
View Details