Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRL Peptide - middle region

NRL Peptide - middle region

Product Specifications

Product Name Alternative

D14H14S46E

UniProt

P54846

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129546.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC gamma Recombinant Rabbit Monoclonal Antibody [JG69-32]
ET7108-42 100 µL

PKC gamma Recombinant Rabbit Monoclonal Antibody [JG69-32]

Sign In for Pricing
View Details
Iso Cephalomannine
TRC-I789500-1MG 1 mg

Iso Cephalomannine

Sign In for Pricing
View Details
Mouse Phospholamban (PLN) ELISA Kit
RDR-PLN-Mu-01 96 Tests

Mouse Phospholamban (PLN) ELISA Kit

Sign In for Pricing
View Details
Mouse Phospholamban (PLN) ELISA Kit
RDR-PLN-Mu-02 48 Tests

Mouse Phospholamban (PLN) ELISA Kit

Sign In for Pricing
View Details
E7 Mouse Monoclonal Antibody [Clone ID: 3D6F1]
AM06265SU-N 100 µL

E7 Mouse Monoclonal Antibody [Clone ID: 3D6F1]

Sign In for Pricing
View Details
Fascin 2 (FSCN2) Human Gene Knockout Kit (CRISPR)
KN421223 1 Kit

Fascin 2 (FSCN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details