Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRL Peptide - middle region

NRL Peptide - middle region

Product Specifications

Product Name Alternative

D14H14S46E

UniProt

P54846

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129546.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triethyltin Bromide
TRC-T778200-2.5G 2.5 g

Triethyltin Bromide

Sign In for Pricing
View Details
BAG5 Mouse Monoclonal Antibody [Clone ID: OTI4E12]
CF810632 100 µg

BAG5 Mouse Monoclonal Antibody [Clone ID: OTI4E12]

Sign In for Pricing
View Details
Zardaverine
TRC-Z150600-500MG 500 mg

Zardaverine

Sign In for Pricing
View Details
METTL19 (TRMT44) Human Gene Knockout Kit (CRISPR)
KN415239 1 Kit

METTL19 (TRMT44) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant HLA-DRA Antibody
RC-15443-01 50 μL

Recombinant HLA-DRA Antibody

Sign In for Pricing
View Details
Recombinant HLA-DRA Antibody
RC-15443-02 100 µL

Recombinant HLA-DRA Antibody

Sign In for Pricing
View Details