Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LBP Peptide - middle region

LBP Peptide - middle region

Product Specifications

Product Name Alternative

Ly88, Bpifd2

UniProt

Q61805

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032515.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HISGNVGWLLNLFHNQIESKLQKVLENKVCEMIQKSVTSDLQPYLQTLPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Neural tissue
CB507015 1 Block

Frozen Tissue Blocks, Neural tissue

Sign In for Pricing
View Details
Anti-PELI1
Y058749 100 µg

Anti-PELI1

Sign In for Pricing
View Details
TGF beta 2 (TGFB2) (NM_001135599) Human Over-expression Lysate
LC427631 20 µg

TGF beta 2 (TGFB2) (NM_001135599) Human Over-expression Lysate

Sign In for Pricing
View Details
Vmn1r219 Mouse Gene Knockout Kit (CRISPR)
KN519013 1 Kit

Vmn1r219 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc30a3 Mouse Gene Knockout Kit (CRISPR)
KN516040 1 Kit

Slc30a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phosphoenolpyruvate Carboxylase Microplate Assay Kit
RDSM076 100 Assays

Phosphoenolpyruvate Carboxylase Microplate Assay Kit

Sign In for Pricing
View Details