Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LBP Peptide - middle region

LBP Peptide - middle region

Product Specifications

Product Name Alternative

Ly88, Bpifd2

UniProt

Q61805

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032515.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HISGNVGWLLNLFHNQIESKLQKVLENKVCEMIQKSVTSDLQPYLQTLPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Phthalimidoacetoacetic Acid Ethyl Ester
TRC-P384635-5MG 5 mg

4-Phthalimidoacetoacetic Acid Ethyl Ester

Sign In for Pricing
View Details
HLA F Recombinant Rabbit Monoclonal Antibody [JE54-04]
ET7110-39 100 µL

HLA F Recombinant Rabbit Monoclonal Antibody [JE54-04]

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS808665 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Crude Datura stramonium Lectin (Jimson Weed) -DSA-
L-5700-100 100 mg

Crude Datura stramonium Lectin (Jimson Weed) -DSA-

Sign In for Pricing
View Details
Carboxypeptidase A (CPA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C1]
TA504523AM 100 µL

Carboxypeptidase A (CPA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C1]

Sign In for Pricing
View Details
Gas Chromatography BCHR-108
BCHR-108 1 Unit

Gas Chromatography BCHR-108

Sign In for Pricing
View Details