Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDAC2 Peptide - middle region

HDAC2 Peptide - middle region

Product Specifications

Product Name Alternative

YAF1, Yy1bp, mRPD3, D10Wsu179e

UniProt

P70288

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032255.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRA

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOT1L1 Antibody (C-term)
MBS9211230-01 0.08 mL

GOT1L1 Antibody (C-term)

Sign In for Pricing
View Details
GOT1L1 Antibody (C-term)
MBS9211230-02 0.4 mL

GOT1L1 Antibody (C-term)

Sign In for Pricing
View Details
GOT1L1 Antibody (C-term)
MBS9211230-03 5x 0.4 mL

GOT1L1 Antibody (C-term)

Sign In for Pricing
View Details
Smad1 Polyclonal Antibody, FITC Conjugated
bs-1619R-FITC-01 20 µL

Smad1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Smad1 Polyclonal Antibody, FITC Conjugated
bs-1619R-FITC-02 100 µL

Smad1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Salusin-A Rabbit Polyclonal Antibody
E28PT8052 100 µL

Salusin-A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details