HDAC2 Peptide - middle region
HDAC2 Peptide - middle region
Product Specifications
Product Name Alternative
YAF1, Yy1bp, mRPD3, D10Wsu179e
UniProt
P70288
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_032255.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRA
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9422628-01 0.02 mg
Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit
Sign In for Pricing
View Details MBS9422628-02 0.1 mg
Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit
Sign In for Pricing
View Details MBS9422628-03 1 mg
Recombinant Saccharomyces cerevisiae A-agglutinin-binding subunit
Sign In for Pricing
View Details