Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG5 Peptide - middle region

ATG5 Peptide - middle region

Product Specifications

Product Name Alternative

Apg5l, Atg5l, Paddy, C88337, AW319544, 2010107M05Rik, 3110067M24Rik

UniProt

Q99J83

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001300942.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPPEENGFRYIPFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AHCY Protein Vector (Human) (pPM-C-HA)
11554022 500 ng

AHCY Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CD3254
BUP22014 1 mg

CD3254

Sign In for Pricing
View Details
KLK2, 25-261aa, Human, His-tag, Baculovirus
E53A02747 50 µg

KLK2, 25-261aa, Human, His-tag, Baculovirus

Sign In for Pricing
View Details
Ldh1 Polyclonal Antibody, Biotin Conjugated
A65341-050 50 µL

Ldh1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Rabbit Anti GLDC Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 200ul
IRBAMLGLDCAP761200UL 200 µL

Rabbit Anti GLDC Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 200ul

Sign In for Pricing
View Details
Rat Tecrl Pre-designed siRNA Set A
SI214352A 1 Each

Rat Tecrl Pre-designed siRNA Set A

Sign In for Pricing
View Details