ATG5 Peptide - middle region
ATG5 Peptide - middle region
Product Specifications
Product Name Alternative
Apg5l, Atg5l, Paddy, C88337, AW319544, 2010107M05Rik, 3110067M24Rik
UniProt
Q99J83
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001300942.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPPEENGFRYIPFR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6064050-01 100 mg
2-[2-(Dipropylamino)ethyl]-6-nitrophenyl Acetic Acid Hydrochloride
Sign In for Pricing
View Details MBS6064050-02 5x 100 mg
2-[2-(Dipropylamino)ethyl]-6-nitrophenyl Acetic Acid Hydrochloride
Sign In for Pricing
View Details 
GTR15301034 1 Vial
Lentiviral mouse 4930447C04Rik shRNA (UAS) - Lentiviral mouse 4930447C04Rik shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details