Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CX3CR1 Peptide - middle region

CX3CR1 Peptide - middle region

Product Specifications

UniProt

Q9Z0D9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034117.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFFFIGFFGGIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IQCN activation kit by CRISPRa
GA112956 1 Kit

Human IQCN activation kit by CRISPRa

Sign In for Pricing
View Details
16S V5-V7 Library Preparation Kit for Illumina (Set A)
70810 96 Preparations

16S V5-V7 Library Preparation Kit for Illumina (Set A)

Sign In for Pricing
View Details
CD47 (IAP/964 + B6H12.2), CF488A conjugate, 0.1mg/mL
BNC881029-100 1x 100 µL

CD47 (IAP/964 + B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C18orf56 (TYMSOS) (NM_001012716) Human Over-expression Lysate
LC422818 20 µg

C18orf56 (TYMSOS) (NM_001012716) Human Over-expression Lysate

Sign In for Pricing
View Details
CINP Mouse Monoclonal Antibody [Clone ID: OTI4A11]
CF812283 100 µg

CINP Mouse Monoclonal Antibody [Clone ID: OTI4A11]

Sign In for Pricing
View Details
L-Tryptophan
TRC-T947210-25G 25 g

L-Tryptophan

Sign In for Pricing
View Details