Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CX3CR1 Peptide - middle region

CX3CR1 Peptide - middle region

Product Specifications

UniProt

Q9Z0D9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034117.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFFFIGFFGGIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C12orf26 (METTL25) activation kit by CRISPRa
GA113416 1 Kit

Human C12orf26 (METTL25) activation kit by CRISPRa

Sign In for Pricing
View Details
AKR1C2 (NM_001135241) Human Over-expression Lysate
LY427603 100 µg

AKR1C2 (NM_001135241) Human Over-expression Lysate

Sign In for Pricing
View Details
Calprotectin (MRP14) (S100A9) (CAGB/426), 0.2mg/mL
BNUB0426-500 1x 500 µL

Calprotectin (MRP14) (S100A9) (CAGB/426), 0.2mg/mL

Sign In for Pricing
View Details
S100pbp Mouse Gene Knockout Kit (CRISPR)
KN515246 1 Kit

S100pbp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BOLA1 Rabbit Polyclonal Antibody
TA365525 100 µL

BOLA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF594 conjugate, 0.1mg/mL
BNC941925-500 1x 500 µL

P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details