Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHBG Peptide - middle region

SHBG Peptide - middle region

Product Specifications

Product Name Alternative

ABP

UniProt

P97497

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035497.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QEPVMVMTIDLTKISKPHSSFEFRTWDPEGVIFYGDTNTEDDWFLLGLRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5HT1B Receptor Rabbit Polyclonal Antibody (PE-Cy5)
orb902295 100 µL

5HT1B Receptor Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Rps1802 Antibody
orb856085 2 mg

Rps1802 Antibody

Sign In for Pricing
View Details
Vps35 Rat Pre-designed siRNA Set A
HY-RS27600 1 Set

Vps35 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
PIM3 ELISA Kit (Human)
OKCD09396-96W 96 Well

PIM3 ELISA Kit (Human)

Sign In for Pricing
View Details
Human G Protein-coupled Receptor 88,GPR88 ELISA KIT
JOT-EK6459Hu-01 96 Well

Human G Protein-coupled Receptor 88,GPR88 ELISA KIT

Sign In for Pricing
View Details
Human G Protein-coupled Receptor 88,GPR88 ELISA KIT
JOT-EK6459Hu-02 48 Well

Human G Protein-coupled Receptor 88,GPR88 ELISA KIT

Sign In for Pricing
View Details