Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTC Peptide - C-terminal region

OTC Peptide - C-terminal region

Product Specifications

Product Name Alternative

Sf, spf, AI265390

UniProt

P11725

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032795.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat Sal-Like Protein 1 (SALL1) ELISA Kit
MBS9913356 Inquire

Cat Sal-Like Protein 1 (SALL1) ELISA Kit

Sign In for Pricing
View Details
Myoferlin Recombinant Rabbit mAb
BS47681-01 50 µL

Myoferlin Recombinant Rabbit mAb

Sign In for Pricing
View Details
Myoferlin Recombinant Rabbit mAb
BS47681-02 100 µL

Myoferlin Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rabbit Polyclonal SETDB1 Antibody
NBP2-20322 0.1 mL

Rabbit Polyclonal SETDB1 Antibody

Sign In for Pricing
View Details
CD38 Polyclonal Antibody
MBS2564482-01 0.02 mL

CD38 Polyclonal Antibody

Sign In for Pricing
View Details
CD38 Polyclonal Antibody
MBS2564482-02 0.06 mL

CD38 Polyclonal Antibody

Sign In for Pricing
View Details