TCF4 Peptide - middle region
TCF4 Peptide - middle region
Product Specifications
Product Name Alternative
ME2, TFE, E2-2, E2.2, ITF2, SEF2, ITF-2, SEF-2, Tcf-4, ASP-I2, ITF-2b, SEF2-1, MITF-2A, MITF-2B, bHLHb19, 5730422P05Rik
UniProt
Q60722
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001077436.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD
More Discoveries
Explore Other Products
Browse additional items from our catalog
RR205722L3V 200 µL
Olr830 (NM_001000900) Rat Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS1032271-01 0.02 mg (E-Coli)
Recombinant Escherichia coli O9:H4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)
Sign In for Pricing
View Details