Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF4 Peptide - middle region

TCF4 Peptide - middle region

Product Specifications

Product Name Alternative

ME2, TFE, E2-2, E2.2, ITF2, SEF2, ITF-2, SEF-2, Tcf-4, ASP-I2, ITF-2b, SEF2-1, MITF-2A, MITF-2B, bHLHb19, 5730422P05Rik

UniProt

Q60722

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001077436.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SOHLH1 knockout cell line
ABC-KH14417 1 Vial

Human SOHLH1 knockout cell line

Sign In for Pricing
View Details
SOX5 Antibody
A35453-100UL 100 µL

SOX5 Antibody

Sign In for Pricing
View Details
Mitochondria GFP Tag Human Umbilical Vein Endothelial Cells
cAP-0001GFP-Mitochon 1 Frozen Vial

Mitochondria GFP Tag Human Umbilical Vein Endothelial Cells

Sign In for Pricing
View Details
NACA2 CytoSection
TS409370P5 25 Slides

NACA2 CytoSection

Sign In for Pricing
View Details
Porcine Kallikrein 12 (KLK12) ELISA Kit
MBS2613762-01 48 Well

Porcine Kallikrein 12 (KLK12) ELISA Kit

Sign In for Pricing
View Details
Porcine Kallikrein 12 (KLK12) ELISA Kit
MBS2613762-02 96 Well

Porcine Kallikrein 12 (KLK12) ELISA Kit

Sign In for Pricing
View Details