Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JUNB Peptide - middle region

JUNB Peptide - middle region

Product Specifications

UniProt

P09450

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032442.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPNSNGVITTTPTPPGQYFYPRGGGSGGGTGGGVTEEQEGFADGFVKALD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCN7A Antibody
orb194957-01 50 μL

SCN7A Antibody

Sign In for Pricing
View Details
SCN7A Antibody
orb194957-02 100 µL

SCN7A Antibody

Sign In for Pricing
View Details
Recombinant Human KLHL22 Protein, N-His
E55P4772 50 µg

Recombinant Human KLHL22 Protein, N-His

Sign In for Pricing
View Details
DUSP11 Antibody (Biotin)
orb686647-01 50 μL

DUSP11 Antibody (Biotin)

Sign In for Pricing
View Details
DUSP11 Antibody (Biotin)
orb686647-02 100 µL

DUSP11 Antibody (Biotin)

Sign In for Pricing
View Details
LTK Blocking Peptide
33R-3281 0.1 mg

LTK Blocking Peptide

Sign In for Pricing
View Details