JUNB Peptide - middle region
JUNB Peptide - middle region
Product Specifications
UniProt
P09450
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_032442.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VPNSNGVITTTPTPPGQYFYPRGGGSGGGTGGGVTEEQEGFADGFVKALD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
48973116 3x 1.0 µg
Ube2h sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details 
MBS1582984-01 50 Tests
Anti-Human VIM/Vimentin Antibody (SAA0112), PerCP
Sign In for Pricing
View Details MBS1582984-02 100 Tests
Anti-Human VIM/Vimentin Antibody (SAA0112), PerCP
Sign In for Pricing
View Details MBS1582984-03 5x 100 Tests
Anti-Human VIM/Vimentin Antibody (SAA0112), PerCP
Sign In for Pricing
View Details