Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICALCL Peptide - C-terminal region

MICALCL Peptide - C-terminal region

Product Specifications

Product Name Alternative

RSB-11-77

UniProt

Q4G091

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQLLQEWFKLVLEKNKLMRYESELLIMAQELELEDHQSRLEQKLRQKMLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleophosmin (NPM1) (NM_001037738) Human Recombinant Protein
TP310458 20 µg

Nucleophosmin (NPM1) (NM_001037738) Human Recombinant Protein

Sign In for Pricing
View Details
UBA5 Human qPCR Primer Pair (NM_198329)
HP226071 200 Reactions

UBA5 Human qPCR Primer Pair (NM_198329)

Sign In for Pricing
View Details
CD1a Rabbit Polyclonal Antibody
ER1902-73 100 µL

CD1a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
rac 3-Hydroxybutyric Acid-d2 Sodium Salt
TRC-H833023-10MG 10 mg

rac 3-Hydroxybutyric Acid-d2 Sodium Salt

Sign In for Pricing
View Details
Granulocyte-Colony Stimulating Factor (G-CSF) (rCSF3/900), CF647 conjugate, 0.1mg/mL
BNC473638-100 1x 100 µL

Granulocyte-Colony Stimulating Factor (G-CSF) (rCSF3/900), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-(4-Chlorophenyl)-1-phenylethanol
TRC-C380475-25MG 25 mg

1-(4-Chlorophenyl)-1-phenylethanol

Sign In for Pricing
View Details