Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICALCL Peptide - C-terminal region

MICALCL Peptide - C-terminal region

Product Specifications

Product Name Alternative

RSB-11-77

UniProt

Q4G091

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQLLQEWFKLVLEKNKLMRYESELLIMAQELELEDHQSRLEQKLRQKMLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usf2 Mouse Gene Knockout Kit (CRISPR)
KN518758 1 Kit

Usf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethoprophos (~90%)
TRC-E890530-1G 1 g

Ethoprophos (~90%)

Sign In for Pricing
View Details
CD51 (ITGAV) Human Knockdown Lysate
LY300214 100 µg

CD51 (ITGAV) Human Knockdown Lysate

Sign In for Pricing
View Details
Human DHDH activation kit by CRISPRa
GA109104 1 Kit

Human DHDH activation kit by CRISPRa

Sign In for Pricing
View Details
Enterokinase (TMPRSS15) (C-term) Rabbit Polyclonal Antibody
AP53473PU-N 400 µL

Enterokinase (TMPRSS15) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DPH2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A12]
TA504855AM 100 µL

DPH2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A12]

Sign In for Pricing
View Details