Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A6OS Peptide - middle region

SLC7A6OS Peptide - middle region

Product Specifications

Product Name Alternative

2010007L18Rik, 2400002F02Rik

UniProt

Q7TPE5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001007568.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WIENIMSVQPYSQEWELVNDDEQSEDIYEDEDDENSENNWRNEYPDEESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-9E3), 0.2mg/mL
BNUB0010-100 1x 100 µL

MART-1 / Melan-A (M2-9E3), 0.2mg/mL

Sign In for Pricing
View Details
(3alpha,5alpha)-13-Ethyl-3-hydroxygonan-17-one
TRC-E368180-100MG 100 mg

(3alpha,5alpha)-13-Ethyl-3-hydroxygonan-17-one

Sign In for Pricing
View Details
(2R,3R)-Benzhydryl 2,3-Bis(benzyloxy)-4-((bis(benzyloxy)phosphoryl)oxy)butanoate
TRC-B189205-25MG 25 mg

(2R,3R)-Benzhydryl 2,3-Bis(benzyloxy)-4-((bis(benzyloxy)phosphoryl)oxy)butanoate

Sign In for Pricing
View Details
HRP-conjugated beta Tubulin Monoclonal Antibody
AN00293HP-01 25 µL

HRP-conjugated beta Tubulin Monoclonal Antibody

Sign In for Pricing
View Details
HRP-conjugated beta Tubulin Monoclonal Antibody
AN00293HP-02 100 µL

HRP-conjugated beta Tubulin Monoclonal Antibody

Sign In for Pricing
View Details
Relaxin 2 (RLN2) Rabbit Polyclonal Antibody
AP02205SU-N 100 µL

Relaxin 2 (RLN2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details