Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BECN1 Peptide - C-terminal region

BECN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Beclin-1

UniProt

O88597

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_062530.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

R 428
TRC-R060020-1MG 1 mg

R 428

Sign In for Pricing
View Details
USP33 (NM_201624) Human Over-expression Lysate
LC404486 20 µg

USP33 (NM_201624) Human Over-expression Lysate

Sign In for Pricing
View Details
CD20 Recombinant Rabbit Monoclonal Antibody [PD00-02]
HA721138 100 µL

CD20 Recombinant Rabbit Monoclonal Antibody [PD00-02]

Sign In for Pricing
View Details
EASYStep Pro Chicken Estriol (E3) ELISA Kit
RDEp-E3-Ch 96 Tests

EASYStep Pro Chicken Estriol (E3) ELISA Kit

Sign In for Pricing
View Details
2-(O-DMT)-6-(Retinamide)-1-hexanol (>85%)
TRC-B213300-1G 1 g

2-(O-DMT)-6-(Retinamide)-1-hexanol (>85%)

Sign In for Pricing
View Details
FKBP52 (FKBP4) Human Gene Knockout Kit (CRISPR)
KN200713BN 1 Kit

FKBP52 (FKBP4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details