Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BECN1 Peptide - C-terminal region

BECN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Beclin-1

UniProt

O88597

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_062530.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGB3 Recombinant Rabbit Monoclonal Antibody [JE63-39]
HA722033 100 µL

HMGB3 Recombinant Rabbit Monoclonal Antibody [JE63-39]

Sign In for Pricing
View Details
Recombinant Human BLNK/Ly-57 Protein (His Tag)
PKSH033753-01 10 µg

Recombinant Human BLNK/Ly-57 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human BLNK/Ly-57 Protein (His Tag)
PKSH033753-02 50 µg

Recombinant Human BLNK/Ly-57 Protein (His Tag)

Sign In for Pricing
View Details
TUFT1 Polyclonal Antibody
E-AB-52622-01 20 µL

TUFT1 Polyclonal Antibody

Sign In for Pricing
View Details
TUFT1 Polyclonal Antibody
E-AB-52622-02 60 µL

TUFT1 Polyclonal Antibody

Sign In for Pricing
View Details
TUFT1 Polyclonal Antibody
E-AB-52622-03 120 µL

TUFT1 Polyclonal Antibody

Sign In for Pricing
View Details